General Information

  • ID:  hor005554
  • Uniprot ID:  P81191
  • Protein name:  Relaxin-like protein AGF A chain
  • Gene name:  NA
  • Organism:  Hypanus sabinus (Atlantic stingray) (Dasyatis sabina)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hypanus (genus), Dasyatidae (family), Dasyatoidea (superfamily), Myliobatiformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ARYKPPLSKKCCSTGCNREDFRGYCYL
  • Length:  27(55-81)
  • Propeptide:  WPRGPDYTERRVMCGLQYVRAAISICGPNMQTMRPRNGSGPIVPPPDFLAMYGMARYKPPLSKKCCSTGCNREDFRGYCYL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Uncertain.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45977
  • Structure ID:  AF-P81191-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005554_AF2.pdbhor005554_ESM.pdb

Physical Information

Mass: 362359 Formula: C136H212N40O39S4
Absent amino acids: HIMQVW Common amino acids: C
pI: 8.99 Basic residues: 6
Polar residues: 13 Hydrophobic residues: 4
Hydrophobicity: -87.78 Boman Index: -7174
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.59
Instability Index: 608.52 Extinction Coefficient cystines: 4720
Absorbance 280nm: 181.54

Literature

  • PubMed ID:  9271504
  • Title:  Identification of a glycosylated relaxin-like molecule from the male Atlantic stingray, Dasyatis sabina.